GIP dosage and evidence
Written by Aaron CuhaReviewed Sep 2026
The short answer
GIP is one of two gut hormones that tell your pancreas to release insulin after a meal. It is the G in tirzepatide and the other drugs that hit two or three hormone targets. In people, drugs that switch its receptor on and drugs that block it have both caused weight loss. Nobody has explained why.
Evidence grade for GIP: Limited. The rule: people have taken it in a published study, but fewer than 100 of them. The sum on this page: 2 completed trials, 10 people given it. A grade counts how much has been done to people, not whether it works.
- People given it
- 10
- Human studies
- 2
- Found nothing
- 0
Dose
No human dose established
Amounts that were given in studies sit in Human evidence on this page. None of them is a personal dose.
2 completed trials, 10 people given it
2 effects reported, 2 unwanted, by people using it, not a trial
Goal pages: Fat loss and metabolism
In plain English
In plain English, from Aaron
This is how I would explain it to a friend. The evidence, with the numbers, is further down the page.
GIP is a hormone your gut makes when you eat. It tells your pancreas to put out more insulin, but only when your blood sugar is up. It is the G behind tirzepatide and similar weight loss shots. It is not a drug you can take. It is only used in research.
What people take it for
- Nobody takes it. People look it up to understand tirzepatide and the drugs like it.
- Working out whether the GIP part of those drugs helps weight loss or not.
- Bones, because GIP slows bone breakdown in short lab tests.
What studies in people showed
Nobody has tested GIP itself as a treatment. The human studies are short drips in small groups, usually 10 to 30 people. They show it boosts insulin when sugar is high, and much less in type 2 diabetes. The boost does not wear off with repeat doses. It also slows bone breakdown for a few hours, in at least five studies. That is a blood marker, not fewer broken bones. The weight results belong to drugs that hit its receptor. In 142 people over four weeks, tirzepatide brought blood sugar and weight down. Then a drug that blocks the same receptor also caused weight loss. Nobody knows why both work.
What people report
Reports, not study results
The good
- We have not collected user reports on this one. Nobody takes GIP outside a lab.
The bad
- In the first tirzepatide study, which hits the GIP receptor, feeling sick, vomiting and less appetite were the common problems.
- Nobody has measured what giving GIP does over months, so its long-term safety is unknown.
Where these come from: The numbers and side effects come from the human studies on this page. There are no forum or clinic reports, because GIP is only used in research.
My bottom line
GIP is worth understanding if you are on tirzepatide or thinking about it. It is not something you take. And anyone who tells you exactly how the G part helps is telling you more than the science knows.
An opinion, not a finding. I am a coach, not a doctor.
What it has been measured to do
Measured in people
Goals GIP has been tested for in people, biggest studies first. We count only what the studies on this page say, so the real numbers may be higher.
- Losing weightno headcount stated · 1 study
- Blood sugar and insulinno headcount stated · 1 study
34 of the 36 indexed goals have no study of any kind behind GIP
No study in people, animals or cells on this page reports a result for these. That does not prove GIP does nothing for them. It does mean anything you have heard about GIP and one of these did not come from a study cited here.
Show full evidence
What is GIP?
GIP is one of two gut hormones that tell your pancreas to release insulin after a meal. It is the G in tirzepatide and the other drugs that hit two or three hormone targets. In people, drugs that switch its receptor on and drugs that block it have both caused weight loss. Nobody has explained why.
GIP is a hormone your gut makes when you eat. It comes from cells in the upper small intestine. It boosts the insulin your pancreas puts out, but only when your blood sugar is up. If you have read about tirzepatide or retatrutide, GIP is the G in how those drugs are described. You cannot judge a drug that targets a hormone switch without knowing what normally flips it. That is why this page exists.
The odd thing about GIP is not the insulin. It is that nobody agrees which way to push it. Tirzepatide switches the GIP receptor on, and people lose a lot of weight. Maridebart cafraglutide blocks the same receptor, and people lost weight on that too. Both results come from human trials. This page reports that puzzle. It does not solve it, because nobody has.
How does GIP work?
GIP docks on its own receptor. In the insulin-making cells of the pancreas, that boosts insulin release when blood sugar is high. When blood sugar is normal, it does not push insulin out. The same receptor also sits in fat, bone and the brain, and most of the recent human work is about those places. An enzyme called DPP-4 breaks GIP down fast. That is the same enzyme the DPP-4 diabetes pills block.
What have studies in people found about GIP?
Lots of studies of how the body handles it, and no treatment trials. Researchers have dripped GIP into people's veins for decades to see what it does, so that record is deep. Nobody has ever tested plain GIP as a treatment for anything.
- Bone: GIP slows the breakdown of bone for a few hours. At least five studies found this, and blocking the receptor dulls it. This is the most repeated effect outside blood sugar.
- Insulin: GIP boosts insulin only when blood sugar is up. In type 2 diabetes that boost is much weaker.
- The boost does not wear off with repeated doses. A study in people with type 2 diabetes, their close relatives and healthy people found no fading. That goes against a claim you will see a lot.
- Fat: GIP acts on the fat just under the skin. It helps fat get stored and opens up tiny blood vessels there. The effect is weaker in people with obesity and partly comes back after weight loss.
- Gut blood flow: human studies show GIP helps control blood flow to the gut after a meal.
- Growth hormone: blocking the GIP receptor stopped odd growth hormone release in some people with acromegaly, a growth hormone disorder. The word some is the authors' own.
What this does not tell you: Every human GIP study here is a short drip in a small group, usually 10 to 30 people. They measured how the body responds, not health results. Nothing shows that giving GIP changes weight, long-term blood sugar, broken bones or any other health result. The bone findings are a blood marker of bone breakdown, not fewer fractures. GIP matters for obesity because of drugs that hit its receptor, not because of the hormone itself.
The state of the research
The honest headline on GIP is a contradiction nobody has settled. In 2002, mice bred without the GIP receptor did not get fat on a fattening diet. That suggested blocking it was the way to go. Two decades later tirzepatide, which switches that same receptor on, became one of the strongest weight loss drugs ever approved. Then maridebart cafraglutide, which blocks it, caused weight loss in a human trial.
Both directions work in people. There are ideas about why. One is that switching the receptor on for a long time wears it out, so it ends up acting like a block. Another is that it does different things in the brain and in the body. None is proven. Other sites often tell a tidy story about GIP boosting GLP-1. That story may be right. It is not settled. If you are deciding what to take, you should know that how the drug works is still argued over.
The evidence, in charts
Fig. 1a · how many people
10people, across 1 study in people cited here
| Study | People | Share |
|---|---|---|
| Diabetologia 2018 | 10 | 100% |
The whole total is one study of 10. Counts are the number of people each study on this page says it signed up. That includes studies that only watched people and gave nobody the compound. 5 more studies in people give no headcount and are not counted here. Studies still signing people up are left out, and only studies cited on this page are counted.
Fig. 1b · evidence mix
6 of 7 sources here are studies in people. The rest is not.
- Study in people · done in people686%
- Animal study · done in animals114%
Counted from the list of sources on this page. It counts only what we cite, so there may be more studies out there. A review counts once, however many studies it sums up.
Fig. 2 · evidence over time
The studies cover 4 different years, 2002 to 2025, counted from the list of sources on this page.
Fig. 3 · legal status at a glance
US
Not approved
UK
Not approved
AU
Not approved
CA
Not approved
Not approved in any of the four countries shown. This is what the law says, not a verdict on the science. See Legal status below for the full text and any notes.
Fig. 4 · how much does what
Nobody has tested different amounts in people
This chart would show how the effect changes as the amount goes up. For this compound, nobody has measured that in people. So we leave it empty. We will not borrow an animal chart and pretend it works the same in people.
Fig. 5 · what the molecule is
- Kind of compound
- Peptide
- Molecule weight
- Mature peptide is 42 amino acids (residues 52 to 93 of the 153-residue precursor, UniProt P09681). The precursor is 17,108 Da; we do not assert a mature-peptide mass because no source we loaded states one.
- Half-life
- Stated in words, not a numbersee the exact wording below
- Chain length
- 42 amino acidscounted from the chain below
Half-life as stated on file: Short. Inactivated by dipeptidyl peptidase-4. No single agreed numeric half-life for intact human GIP resolved in our sources, so none is asserted here.
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
- Water-shy 17
- Water-loving 13
- Acidic 5
- Basic 7
One square per amino acid, left to right from the start of the chain, coloured by type. The type is a fact about the amino acid, not a finding about this compound.
The studies we cite
- Study in people2018LY3298176, a novel dual GIP and GLP-1 receptor agonist for the treatment of type 2 diabetes mellitus: from discovery to clinical proof of concept
This is where tirzepatide starts. 142 people took it, a dummy shot, or an older diabetes drug, dulaglutide, for comparison. Some were healthy and some had type 2 diabetes. Over four weeks, the higher doses brought fasting blood sugar down and took weight off. Feeling sick, vomiting and less appetite were the common problems, all mild to moderate. This was a first safety study, not a test of long-term benefit.
The first-in-human characterisation of the molecule that became tirzepatide. This is the paper that connects GIP receptor agonism to the drug most readers of this page came here from.
- Study in people2025Once-monthly maridebart cafraglutide for the treatment of obesity: a phase 2 trial
People lost weight on a drug that blocks the GIP receptor. That is the puzzle on this page, because tirzepatide switches the same receptor on and people lose weight on that too. This drug pairs a GIP blocker with a GLP-1 drug, given once a month. Nobody has explained how both directions can work. This was a mid-sized trial, so it is a signal. Which approach is better is still an open question.
The other half of the paradox. Maridebart cafraglutide pairs GLP-1 receptor agonism with a GIP receptor ANTAGONIST antibody, and it produced weight loss in a randomised phase 2 trial. Blocking the receptor tirzepatide activates also works.
- Study in people2018GIP(3-30)NH2 is an efficacious GIP receptor antagonist in humans: a randomised, double-blinded, placebo-controlled, crossover study
Researchers found a way to switch GIP off in people. A short, natural piece of GIP turned out to block the GIP receptor. Ten healthy men each took part in four sessions on different treatments, with their blood sugar held steady by a drip. That gave researchers a tool to turn the hormone off and see what changes. Ten healthy men is a very small group. This paper is about a method, not about treating anyone.
Ten healthy men, four-period crossover under hyperglycaemic clamp. A naturally occurring truncated fragment of GIP blocks its own receptor in people, which is the tool that made human GIP antagonism studies possible at all.
- Study in people2018Glucose-dependent insulinotropic polypeptide (GIP) inhibits bone resorption independently of insulin and glycemia
GIP slows the breakdown of bone, and it does not need insulin or blood sugar to do it. Blood markers of bone breakdown dropped on the hormone compared with a control. The effect held when insulin and blood sugar were taken into account. This is the most repeated human effect of GIP outside blood sugar. It was measured in blood over hours. Nobody checked whether bones got stronger or broke less.
Randomised. GIP acutely suppresses bone resorption, and does so independently of insulin and blood glucose. This is the best-replicated non-glycaemic human effect of GIP.
- Study in people2020GIP's effect on bone metabolism is reduced by the selective GIP receptor antagonist GIP(3-30)NH2
Blocking the GIP receptor took the bone effect away. That shows the effect really comes through this receptor and is not a side effect of something else GIP sets off. Volunteers got GIP with or without the blocking piece. With the blocker, the drop in bone breakdown was dulled. This is still a blood marker measured over hours in a small group. No broken bones and no bone density were measured.
Randomised. Blocking the receptor blunts the bone effect, which is the pharmacological proof that the bone finding is GIPR-mediated rather than incidental.
- Study in people2020No evidence of tachyphylaxis for insulinotropic actions of glucose-dependent insulinotropic polypeptide (GIP) in subjects with type 2 diabetes, their first-degree relatives, or in healthy subjects
A claim repeated for years turned out to be false. The worry was that the body stops responding to GIP after repeated doses, which would explain why it looks weak in diabetes. Researchers tested people with type 2 diabetes, their close relatives, and healthy volunteers. The insulin response did not fade in any of the three groups. These were short lab tests, not months of treatment.
A negative result against a widely repeated claim. GIP responsiveness does not appear to degrade on repeated exposure, in any of the three groups tested.
- Animal study2002Inhibition of gastric inhibitory polypeptide signaling prevents obesity
In mice. Mice bred without the GIP receptor did not get fat on a fattening diet. This is where the whole switch it on or block it question started. It is a mouse result, which is why it took two decades of human work to even begin testing it.
Mouse. GIP receptor knockout mice are protected against diet-induced obesity. This is the origin of the entire agonism-versus-antagonism question and it is a mouse result, which is why the question took two decades of human work to even begin testing.
Where to buy GIP
1 seller lists GIP in our latest read. They are ranked by trust score, then by archive rating, then by certificate tier, then by the lowest price per milligram. Archive evidence is counted before source-backed. Each path is out of 4, and the two are not added. A higher price does not raise the score. The letter is the certificate chip. 0 of them have a published certificate that names GIP.
Some seller links may pay this site when you buy through them. A payment never changes a seller's tier or rank, and no seller has a say in any page.
| Seller | Trust score | Vial sizes | From, per mg | Certificate for GIP | Seller link |
|---|---|---|---|---|---|
| Axon Peptide | 30 WeakSource-backed 1 of 4. Archive evidence 1 of 4.C | 5 mg, 10 mg, 20 mg, 30 mg, 40 mg, 50 mg, 60 mg | $3.17 | None found for GIP | View |
- LC Lab-confirmed: the issuing laboratory echoed this certificate back
- A Current certificate, independent laboratory named, laboratory not yet checked
- B Certificate published, but no laboratory link, older than a year, or the laboratory did not recognise the published lookup
- C No certificate could be read
Every listing and vial size for GIP · How the trust score is counted
Sellers named on the price pages are ranked by certificate tier, then price, and any affiliate income is disclosed there. Naming a seller is not a recommendation to buy or use anything.
Common questions
Has GIP been tested in people?
Yes. 10 people given it across 2 completed trials cited here, 0 of which found nothing. GIP is one of two gut hormones that tell your pancreas to release insulin after a meal. It is the G in tirzepatide and the other drugs that hit two or three hormone targets. In people, drugs that switch its receptor on and drugs that block it have both caused weight loss. Nobody has explained why.
What is the GIP dosage?
No human dose established. Amounts that were given in studies sit in Human evidence on this page. None of them is a personal dose. 2 completed trials, 10 people given it
Is GIP FDA-approved?
Not an approved drug, and not used as a treatment. Drugs that work on its receptor are approved, including tirzepatide.
Is GIP something I can take?
No. It is a hormone your gut already makes. It is not an approved drug anywhere. Researchers drip it into volunteers to study how the body works. The drugs on this site act on its receptor. They are not GIP.
Why does tirzepatide activate GIP receptors if blocking them also causes weight loss?
Nobody knows, and that is the most interesting thing about this hormone. Switching the receptor on and blocking it have both caused weight loss in human trials. One idea is that switching it on for a long time wears it out, so it acts like a block. Another is that it does different things in the brain and the body. Neither is proven.
What does GIP do besides insulin?
The most repeated effect outside blood sugar is on bone. GIP slows bone breakdown for a few hours, shown in several studies, and blocking the receptor dulls it. It also acts on fat, helping fat get stored and raising blood flow there. That fat effect is weaker in people with obesity.
Is the GIP bone finding a reason to expect fewer fractures on a GIP drug?
No. Those studies measured a blood marker of bone breakdown over a few hours, not broken bones over years. A marker moving the right way is a reason to run the longer study. It is not a stand-in for it.