Oxyntomodulin dosage and evidence
Written by Aaron CuhaReviewed Sep 2026
The short answer
Oxyntomodulin is glucagon with eight extra building blocks on the end. That tail lets it weakly switch on two hormone receptors at once, glucagon's and GLP-1's. It is the natural model for every drug that hits both.
Evidence grade for Oxyntomodulin: Limited. The rule: people have taken it in a published study, but fewer than 100 of them. The sum on this page: 1 completed trial, 13 people given it. A grade counts how much has been done to people, not whether it works.
- People given it
- 13
- Human studies
- 1
- Found nothing
- 1
Dose
No human dose established
Amounts that were given in studies sit in Human evidence on this page. None of them is a personal dose.
1 completed trial, 13 people given it
No first-hand reports gathered yet. That is a gap in what we have collected, not a finding that nothing has been reported.
Goal pages: Fat loss and metabolism, Ageing and longevity
In plain English
In plain English, from Aaron
This is how I would explain it to a friend. The evidence, with the numbers, is further down the page.
Oxyntomodulin is a gut hormone you release after meals. It is glucagon with a short tail added. That tail lets it weakly hit two hunger and sugar switches at once. Newer weight loss drugs copy that trick. The hormone itself is not a drug.
What people take it for
- Understanding the newer drugs that pair GLP-1 with glucagon.
- Weight loss, on the idea that it cuts appetite.
- A faster metabolism, which is the weakest claim made for it.
What studies in people showed
The human trials are small and old. In the longest one, people gave themselves shots before meals for four weeks. They lost 2.3 kg, against 0.5 kg on a dummy shot. In 13 healthy volunteers, one drip cut how much they ate at a buffet by about a fifth. Nobody felt sick. In 15 healthy young men, it cut how much they ate, but it did not raise how much energy they burned. So the weight comes off because people eat less. The burn-more claim comes mostly from rats and mice. Nobody has run a big or long trial.
What people report
Reports, not study results
The good
- People ate less at meals, and nobody in the buffet study felt sick.
- In the four week study, people lost weight.
The bad
- The burn-more claim did not show up in the human test built to check it.
- Nobody has studied it past four weeks, so long-term safety is unknown.
Where these come from: All of this comes from the small human studies on this page. We have not collected user reports on this one yet.
My bottom line
This is the blueprint, not the product. The real drugs built on it are where any benefit lives. Anything sold as plain oxyntomodulin comes with four weeks of data and a lot of hope.
An opinion, not a finding. I am a coach, not a doctor.
What it has been measured to do
Measured in people
Goals Oxyntomodulin has been tested for in people, biggest studies first. We count only what the studies on this page say, so the real numbers may be higher.
- Feeling less hungry13 people · 3 studies · 1 found nothing
- Cell energy and mitochondriano headcount stated · 1 study
34 of the 36 indexed goals have no study of any kind behind Oxyntomodulin
No study in people, animals or cells on this page reports a result for these. That does not prove Oxyntomodulin does nothing for them. It does mean anything you have heard about Oxyntomodulin and one of these did not come from a study cited here.
Show full evidence
What is Oxyntomodulin?
Oxyntomodulin is glucagon with eight extra building blocks on the end. That tail lets it weakly switch on two hormone receptors at once, glucagon's and GLP-1's. It is the natural model for every drug that hits both.
Oxyntomodulin is the glucagon molecule plus a tail of eight building blocks. That one fact explains what it does and why it is on this site. It has no receptor of its own. It weakly switches on the glucagon receptor, and it weakly switches on the GLP-1 receptor. Hitting both at once is the exact design newer drugs copy, including survodutide, mazdutide and pemvidutide.
Your gut releases it after meals, more when you eat more. It comes from the same parent protein as GLP-1 and GLP-2. The human trials of the natural hormone are small and old. They are real and positive, and they stop well short of a treatment.
How does Oxyntomodulin work?
It weakly switches on two receptors, glucagon's and GLP-1's, and has none of its own. The idea behind the pair is that GLP-1 turns down appetite while glucagon raises how much energy you burn. So you might eat less and burn more at the same time. The eat-less half is well shown in people. The burn-more half is where the evidence gets mixed.
What have studies in people found about Oxyntomodulin?
Small, old and real. Volunteers have been given the natural hormone by drip and by shot, against a dummy, and they ate less and lost weight. The trials are tiny by today's standards, and none went past four weeks.
- Four weeks of shots that people gave themselves led to 2.3 kg of weight loss, against 0.5 kg on the dummy.
- One drip into a vein in 13 healthy volunteers cut how much they ate at a buffet by 19.3% and lowered the hunger hormone ghrelin. Nobody felt sick.
- Its effect on how much people eat adds to that of another gut hormone, PYY3-36, in people with extra weight or obesity.
- Drips of three hormones together, GLP-1, oxyntomodulin and PYY, have been compared with gastric bypass surgery and with cutting calories, including a comparison of blood chemicals.
What this does not tell you: The biggest trial of the natural hormone ran four weeks in a small group of volunteers. There is no large final-stage study, no long-term health or safety data, and no approved product. The claim you hear most, that it raises how much energy you burn, rests largely on work in rats and mice. The human data on that point are mixed. Everything useful in this area has come from man-made copies, not the hormone.
The state of the research
Oxyntomodulin matters for its history and its shape, not as a treatment. A whole generation of drugs pairs GLP-1 with glucagon. The reason is that the body already does it, weakly, with a hormone that is glucagon plus eight building blocks. Every dual drug on this site tries to do the same thing harder and for longer.
The caution is on energy burn. That is the exciting half of the sales pitch for these drugs, and it comes mostly from rats and mice. The one human trial built to test it on its own found a mixed picture. A page that repeats the boosts-your-metabolism claim without saying which animal it came from has not read the trial.
The evidence, in charts
Fig. 1a · how many people
13people, across 1 study in people cited here
| Study | People | Share |
|---|---|---|
| Journal of Clinical Endocrinology and Metabolism 2003 | 13 | 100% |
The whole total is one study of 13. Counts are the number of people each study on this page says it signed up. That includes studies that only watched people and gave nobody the compound. 3 more studies in people give no headcount and are not counted here. Studies still signing people up are left out, and only studies cited on this page are counted.
Fig. 1b · evidence mix
All 4 sources here are studies in people.
- Study in people · done in people4100%
Counted from the list of sources on this page. It counts only what we cite, so there may be more studies out there. A review counts once, however many studies it sums up.
Fig. 2 · evidence over time
The studies cover 4 different years, 2003 to 2023, counted from the list of sources on this page.
Fig. 3 · legal status at a glance
US
Not approved
UK
Not approved
AU
Not approved
CA
Not approved
Not approved in any of the four countries shown. This is what the law says, not a verdict on the science. See Legal status below for the full text and any notes.
Fig. 4 · how much does what
Nobody has tested different amounts in people
This chart would show how the effect changes as the amount goes up. For this compound, nobody has measured that in people. So we leave it empty. We will not borrow an animal chart and pretend it works the same in people.
Fig. 5 · what the molecule is
- Kind of compound
- Peptide
- Molecule weight
- 37 amino acids, residues 53 to 89 of pro-glucagon (UniProt P01275). No FDA label exists, so no label-derived mass.
- Half-life
- Stated in words, not a numbersee the exact wording below
- Chain length
- 37 amino acidscounted from the chain below
Half-life as stated on file: Short. Rapidly degraded by dipeptidyl peptidase-4. No single verified numeric half-life is asserted here because our sources do not agree on one.
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
- Water-shy 11
- Water-loving 16
- Acidic 3
- Basic 7
One square per amino acid, left to right from the start of the chain, coloured by type. The type is a fact about the amino acid, not a finding about this compound.
The studies we cite
- Study in people2003Oxyntomodulin suppresses appetite and reduces food intake in humans
Given the hormone, people ate less at the next meal. 13 healthy volunteers had sessions on oxyntomodulin and on a dummy drip, and nobody knew which was which. Food eaten at a buffet fell by about a fifth, and food over the next 12 hours fell by about a tenth. Their hunger hormone went down. Nobody felt sick and food did not taste different, which sets it apart from some later drugs. 13 healthy people and one buffet is a very small test.
13 healthy volunteers, randomised double-blind placebo-controlled crossover. Buffet energy intake fell 19.3% and 12-hour intake 11.3%, with ghrelin suppressed. Notably it caused no nausea and did not change how food tasted, which separates it from some later drugs in the class.
- Study in people2005Subcutaneous oxyntomodulin reduces body weight in overweight and obese subjects: a double-blind, randomized, controlled trial
Four weeks of shots before meals took weight off. People with extra weight gave themselves oxyntomodulin three times a day before eating, or a dummy shot. They lost 2.3 kg, against 0.5 kg on the dummy, roughly 0.45 kg a week. How much they ate at a test meal fell by a quarter at the start and by a third by the end. Four weeks is short. Nothing here says whether the loss would last or come straight back.
Self-administered three times daily before meals for four weeks. Bodyweight fell 2.3 kg against 0.5 kg on control (p = 0.0106), roughly 0.45 kg a week, with energy intake at the study meal down 25% at the start and 35% by the end.
- Study in people2015Effect of oxyntomodulin, glucagon, GLP-1, and combined glucagon plus GLP-1 infusion on food intake, appetite, and resting energy expenditure
People ate less, and they did not burn more. 15 healthy young men got oxyntomodulin, GLP-1, glucagon, the last two together, or salt water before a meal, on separate days. Every hormone cut how much they ate, by about the same amount. Giving GLP-1 and glucagon together added nothing. Oxygen use, which is how energy burn is measured, did not shift on any of them. The weight effect comes from eating less, not from burning more.
The trial that separates the appetite claim from the energy expenditure claim by running oxyntomodulin against its two component signals and against the combination. Read this before believing the raises-your-metabolism half of the story.
- Study in people2023Tripeptide gut hormone infusion does not alter food preferences or sweet taste function in volunteers with obesity and prediabetes or diabetes but promotes restraint eating
Three gut hormones together did not change what people wanted to eat. Volunteers with obesity and either prediabetes or diabetes got GLP-1, oxyntomodulin and PYY at once. Their food choices did not shift, and sweet things tasted the same. They did say they held back more at the table. This is here because it found nothing. A popular idea, that these hormones retrain your taste, was tested and did not hold.
A negative secondary analysis, included because it is negative. Combining GLP-1, oxyntomodulin and PYY did not change what people wanted to eat or how sweet things tasted.
Where to buy Oxyntomodulin
1 seller lists Oxyntomodulin in our latest read. They are ranked by trust score, then by archive rating, then by certificate tier, then by the lowest price per milligram. Archive evidence is counted before source-backed. Each path is out of 4, and the two are not added. A higher price does not raise the score. The letter is the certificate chip. 0 of them have a published certificate that names Oxyntomodulin.
Some seller links may pay this site when you buy through them. A payment never changes a seller's tier or rank, and no seller has a say in any page.
| Seller | Trust score | Vial sizes | From, per mg | Certificate for Oxyntomodulin | Seller link |
|---|---|---|---|---|---|
| Boston Molecules | 28 InsufficientSource-backed 1 of 4. Archive evidence 1 of 4.C | 10 mg | $81.0 | None found for Oxyntomodulin | View |
- LC Lab-confirmed: the issuing laboratory echoed this certificate back
- A Current certificate, independent laboratory named, laboratory not yet checked
- B Certificate published, but no laboratory link, older than a year, or the laboratory did not recognise the published lookup
- C No certificate could be read
Every listing and vial size for Oxyntomodulin · How the trust score is counted
Sellers named on the price pages are ranked by certificate tier, then price, and any affiliate income is disclosed there. Naming a seller is not a recommendation to buy or use anything.
Common questions
Has Oxyntomodulin been tested in people?
Yes. 13 people given it across 1 completed trial cited here, 1 of which found nothing. Oxyntomodulin is glucagon with eight extra building blocks on the end. That tail lets it weakly switch on two hormone receptors at once, glucagon's and GLP-1's. It is the natural model for every drug that hits both.
What is the Oxyntomodulin dosage?
No human dose established. Amounts that were given in studies sit in Human evidence on this page. None of them is a personal dose. 1 completed trial, 13 people given it
Is Oxyntomodulin FDA-approved?
Not approved and not sold anywhere. It matters to medicine as a model for designing new drugs.
What is oxyntomodulin, in one sentence?
Glucagon with a tail of eight building blocks, which lets it weakly switch on both the glucagon and the GLP-1 receptor at the same time.
Does it cause weight loss?
In the one four-week trial of the natural hormone, people lost 2.3 kg, against 0.5 kg on the dummy. That is real. It was also a small, short trial, and nobody followed it up with bigger ones.
Why does it matter if it is not a drug?
Because it is the model. Survodutide, mazdutide, pemvidutide and the other GLP-1 and glucagon drugs are built copies of what oxyntomodulin does naturally.
Does it boost metabolism?
That claim is the weakest part of the story. It comes mostly from work in rats and mice. The human trial built to separate eating less from burning more found a mixed result.