Legal status · Canada
Is BNP and nesiritide legal in Canada?
Written by Aaron CuhaReviewed Sep 2026
Direct answer
No. BNP and nesiritide is not an approved medicine in Canada; its classification is "Not approved". Nothing containing it is authorized for any use in people. Vials labeled "for research use only" are not exempt: that label does not make human use lawful. On the evidence, 6 human studies are cited on its profile.
BNP and nesiritide in Canada at a glance
| Classification | Not approved |
|---|---|
| Health Canada approval status | Not approved by Health Canada |
| Human studies cited | 6 of 7 citations on the profile |
| Reviewed | Sep 2026 |
Classification and note come from the BNP and nesiritide profile, checked against Health Canada, Health Products and Food Branch (Health Canada) listings at the reviewed date.
What this means
- 01
No product containing BNP and nesiritide is approved by Health Canada for any use in Canada, so nothing on the market is authorized for people.
- 02
"Research use only" is a vendor label, not a legal category that permits human use. It does not exempt a product from medicines law.
- 03
Importing, supplying or promoting it for human use can fall under medicines legislation in Canada. This page is general information, not legal advice.
What BNP and nesiritide is
The heart hormone that became both the standard blood test for heart failure and a drug that failed. In ASCEND-HF, 7,141 people were randomised to nesiritide or placebo: dyspnoea barely moved, death and rehospitalisation did not change, and the product is listed Discontinued in Drugs@FDA.
B-type natriuretic peptide is a 32 amino acid peptide, sequence SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH, released by ventricular muscle under wall stress. Most readers meet it twice over and the two meanings get confused, so the distinction comes first.
Mechanism: In humans, BNP binds NPR-A (gene NPR1), the same particulate guanylyl cyclase receptor as ANP, raising cyclic GMP to produce vasodilation, natriuresis and suppression of renin and aldosterone. That is the physiology that made a recombinant version look promising in acute heart failure.
Regulatory history: NATRECOR (nesiritide), NDA 020920, Scios LLC, originally approved in 2001 for acutely decompensated heart failure. On the Drugs@FDA query of 11 September 2026 the product is listed Discontinued, with the Federal Register determination that it was not discontinued or withdrawn for safety or effectiveness reasons. BNP and NT-proBNP remain in routine use as diagnostic blood tests, which is a laboratory use, not a drug approval.
How Health Canada treats this kind of product
Authorises drugs for sale through a Notice of Compliance and Drug Identification Number. A compound that is not authorised for sale cannot lawfully be sold for human use, and personal importation of prescription drugs is limited.
The classification above is the The Longevity Archive reading of Health Canada, Health Products and Food Branch listings for BNP and nesiritide at the reviewed date, not a legal opinion. Rules change, and importing, prescribing and possessing a compound can each be treated differently. Check the regulator directly before acting on anything here.
BNP and nesiritide in other countries
Frequently asked questions
Is BNP and nesiritide legal in Canada?
No. BNP and nesiritide is not an approved medicine in Canada; its classification is "Not approved". Nothing containing it is authorized for any use in people. Vials labeled "for research use only" are not exempt: that label does not make human use lawful. On the evidence, 6 human studies are cited on its profile.
Can I buy BNP and nesiritide in Canada?
No approved product exists to buy. In Canada BNP and nesiritide is classified as "Not approved", so there is no licensed pharmacy product. Vendors selling it "for research use only" are not selling it for human use, and that label does not change its legal status. This site does not list or recommend vendors.
Is BNP and nesiritide Health Canada approved?
No. In Canada BNP and nesiritide is classified as "Not approved", which is not a Health Canada marketing approval. For comparison, the US FDA status is: NATRECOR (nesiritide), NDA 020920, Scios LLC, originally approved in 2001 for acutely decompensated heart failure. On the Drugs@FDA query of 11 September 2026 the product is listed Discontinued, with the Federal Register determination that it was not discontinued or withdrawn for safety or effectiveness reasons. BNP and NT-proBNP remain in routine use as diagnostic blood tests, which is a laboratory use, not a drug approval.. On the evidence, 6 human studies are cited on its profile.
Related compounds in Canada
Full research profile
Mechanism, cited studies, FDA status and the full legal summary for BNP and nesiritide live on its compound profile.
BNP and nesiritide profileThis page is general information about the regulatory status of BNP and nesiritide in Canada, current as of Sep 2026. It is not legal advice, and classifications change; check Health Canada, Health Products and Food Branch directly or consult a lawyer for a specific situation. Educational use only. This database summarizes published research. It is not medical advice and contains no dosing protocols or recommendations for personal use. The Longevity Archive has no vendor relationships and does not recommend where to buy anything.