Legal status · United States
Is BNP and nesiritide legal in the United States?
Written by Aaron CuhaReviewed Sep 2026
Direct answer
No. BNP and nesiritide is not an approved medicine in the United States; its classification is "Approved, product discontinued". Nothing containing it is authorized for any use in people. Vials labeled "for research use only" are not exempt: that label does not make human use lawful. On the evidence, 6 human studies are cited on its profile.
BNP and nesiritide in the United States at a glance
| Classification | Approved, product discontinued |
|---|---|
| Note | NDA 020920 (NATRECOR, Scios LLC) is listed Discontinued in Drugs@FDA as of 11 September 2026, and the record carries the Federal Register determination that the product was not discontinued or withdrawn for safety or effectiveness reasons. No current label was returned by the openFDA label database. |
| FDA approval status | NATRECOR (nesiritide), NDA 020920, Scios LLC, originally approved in 2001 for acutely decompensated heart failure. On the Drugs@FDA query of 11 September 2026 the product is listed Discontinued, with the Federal Register determination that it was not discontinued or withdrawn for safety or effectiveness reasons. BNP and NT-proBNP remain in routine use as diagnostic blood tests, which is a laboratory use, not a drug approval. |
| Human studies cited | 6 of 7 citations on the profile |
| Reviewed | Sep 2026 |
Classification and note come from the BNP and nesiritide profile, checked against U.S. Food and Drug Administration (FDA) listings at the reviewed date.
What this means
- 01
No product containing BNP and nesiritide is approved by FDA for any use in the United States, so nothing on the market is authorized for people.
- 02
"Research use only" is a vendor label, not a legal category that permits human use. It does not exempt a product from medicines law.
- 03
Importing, supplying or promoting it for human use can fall under medicines legislation in the United States. This page is general information, not legal advice.
What BNP and nesiritide is
The heart hormone that became both the standard blood test for heart failure and a drug that failed. In ASCEND-HF, 7,141 people were randomised to nesiritide or placebo: dyspnoea barely moved, death and rehospitalisation did not change, and the product is listed Discontinued in Drugs@FDA.
B-type natriuretic peptide is a 32 amino acid peptide, sequence SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH, released by ventricular muscle under wall stress. Most readers meet it twice over and the two meanings get confused, so the distinction comes first.
Mechanism: In humans, BNP binds NPR-A (gene NPR1), the same particulate guanylyl cyclase receptor as ANP, raising cyclic GMP to produce vasodilation, natriuresis and suppression of renin and aldosterone. That is the physiology that made a recombinant version look promising in acute heart failure.
Regulatory history: NATRECOR (nesiritide), NDA 020920, Scios LLC, originally approved in 2001 for acutely decompensated heart failure. On the Drugs@FDA query of 11 September 2026 the product is listed Discontinued, with the Federal Register determination that it was not discontinued or withdrawn for safety or effectiveness reasons. BNP and NT-proBNP remain in routine use as diagnostic blood tests, which is a laboratory use, not a drug approval.
How FDA treats this kind of product
Approves prescription drugs by indication and polices unapproved products, including peptides sold online. Compounding pharmacies may prepare some compounds under a prescription when the FDA places them on a permitted bulk-substances category.
The classification above is the The Longevity Archive reading of U.S. Food and Drug Administration listings for BNP and nesiritide at the reviewed date, not a legal opinion. Rules change, and importing, prescribing and possessing a compound can each be treated differently. Check the regulator directly before acting on anything here.
BNP and nesiritide in other countries
Frequently asked questions
Is BNP and nesiritide legal in the United States?
No. BNP and nesiritide is not an approved medicine in the United States; its classification is "Approved, product discontinued". Nothing containing it is authorized for any use in people. Vials labeled "for research use only" are not exempt: that label does not make human use lawful. On the evidence, 6 human studies are cited on its profile. Note: NDA 020920 (NATRECOR, Scios LLC) is listed Discontinued in Drugs@FDA as of 11 September 2026, and the record carries the Federal Register determination that the product was not discontinued or withdrawn for safety or effectiveness reasons. No current label was returned by the openFDA label database.
Can I buy BNP and nesiritide in the United States?
No approved product exists to buy. In the United States BNP and nesiritide is classified as "Approved, product discontinued", so there is no licensed pharmacy product. Vendors selling it "for research use only" are not selling it for human use, and that label does not change its legal status. This site does not list or recommend vendors. Note: NDA 020920 (NATRECOR, Scios LLC) is listed Discontinued in Drugs@FDA as of 11 September 2026, and the record carries the Federal Register determination that the product was not discontinued or withdrawn for safety or effectiveness reasons. No current label was returned by the openFDA label database.
Is BNP and nesiritide FDA approved?
No. FDA status: NATRECOR (nesiritide), NDA 020920, Scios LLC, originally approved in 2001 for acutely decompensated heart failure. On the Drugs@FDA query of 11 September 2026 the product is listed Discontinued, with the Federal Register determination that it was not discontinued or withdrawn for safety or effectiveness reasons. BNP and NT-proBNP remain in routine use as diagnostic blood tests, which is a laboratory use, not a drug approval.. Current US classification: "Approved, product discontinued". On the evidence, 6 human studies are cited on its profile.
Related compounds in the United States
Full research profile
Mechanism, cited studies, FDA status and the full legal summary for BNP and nesiritide live on its compound profile.
BNP and nesiritide profileThis page is general information about the regulatory status of BNP and nesiritide in the United States, current as of Sep 2026. It is not legal advice, and classifications change; check U.S. Food and Drug Administration directly or consult a lawyer for a specific situation. Educational use only. This database summarizes published research. It is not medical advice and contains no dosing protocols or recommendations for personal use. The Longevity Archive has no vendor relationships and does not recommend where to buy anything.